PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D01G0926
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 180aa    MW: 19827.6 Da    PI: 10.2474
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D01G0926genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.12.5e-15110159352
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                  ++ r +rk+kNRe+A rsR+RK+a++ eLe +v+ L +eN +L+ + ++l
  Gh_D01G0926 110 DDPRHKRKIKNRESAARSRARKQAYTNELELEVARLLEENVKLRRQQDKL 159
                  6889****************************************877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-11108172IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.07110159IPR004827Basic-leucine zipper domain
CDDcd147073.62E-25113165No hitNo description
Gene3DG3DSA:1.20.5.1704.3E-13113160No hitNo description
SuperFamilySSF579591.06E-10113160No hitNo description
PfamPF001701.5E-12113159IPR004827Basic-leucine zipper domain
PROSITE patternPS000360115130IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MEEVWGDITL ASLNDHPAVT PTANPPSFPS VILQDFLAIP INKEMPPTAR SGCGTSLTEE  60
ITLFGSLPPT PATLFTLNAR SIASAAVKAP APSFPSSCRK KGQENGENSD DPRHKRKIKN  120
RESAARSRAR KQAYTNELEL EVARLLEENV KLRRQQDKLL ASPRQIPKRN TLCRTLTAPF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465462.11e-125PREDICTED: protein FD-like
RefseqXP_012465469.11e-125PREDICTED: protein FD-like
RefseqXP_012465476.11e-125PREDICTED: protein FD-like
SwissprotQ84JK29e-41FD_ARATH; Protein FD
TrEMBLA0A0D2Q4X71e-125A0A0D2Q4X7_G
STRINGAT4G35900.12e-38(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19342772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.15e-34bZIP family protein